PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G30440.1
Common NameLOC102714567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family ARR-B
Protein Properties Length: 733aa    MW: 80597.2 Da    PI: 6.6446
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G30440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.62.1e-26200252255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   +r++Wt +LH+ Fveav+qL G ++A+Pk+il++mkv+ +t+e+++SHLQkYRl
  OB06G30440.1 200 TRVVWTADLHRDFVEAVNQL-GVDNAVPKKILQIMKVNYMTRENIASHLQKYRL 252
                   79******************.********************************8 PP

2Response_reg71.63.3e-24191271109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl vdD+p+ ++ll+++l++ +y ++++++d+e al++l+e++  +Dl++ D+ m +mdG++ll+ i  e  +lp+i+ +a+ge e++ + +  Ga 
  OB06G30440.1  19 VLAVDDNPVCLMLLETLLRRCKY-HATTTRDAETALRMLRERTedFDLVISDVHMLEMDGFRLLELIGLEM-DLPVIMQSANGELETMMKGVTHGAC 113
                   799********************.***************777777**********************6644.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l+Kp++ +++ +
  OB06G30440.1 114 DYLVKPVQLKDIKN 127
                   ********999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23009.9E-3715145No hitNo description
SuperFamilySSF521723.7E-3215137IPR011006CheY-like superfamily
SMARTSM004487.4E-2717129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011039.73118133IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.9E-2119127IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.02E-2320132No hitNo description
SuperFamilySSF466899.68E-19196256IPR009057Homeodomain-like
PROSITE profilePS5129410.165196255IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.3E-28197257IPR009057Homeodomain-like
TIGRFAMsTIGR015576.6E-24200252IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 733 aa     Download sequence    Send to blast
MAETHGTEAA GKFPEGMRVL AVDDNPVCLM LLETLLRRCK YHATTTRDAE TALRMLRERT  60
EDFDLVISDV HMLEMDGFRL LELIGLEMDL PVIMQSANGE LETMMKGVTH GACDYLVKPV  120
QLKDIKNIWQ HVVRKRKPDL RSHNRGDNDS ADQKVQSGNA EGGRVGATRT RRKYSRKKRS  180
DGDNYDGNKE NMEFSTQKRT RVVWTADLHR DFVEAVNQLG VDNAVPKKIL QIMKVNYMTR  240
ENIASHLQKY RLYLKRISDY TGMSPDQFPA RWRYMNELQC LKNYHEHGRY HLSPAIASSN  300
SSNPFARMNS ASAMGTHGLL PTQSVQLRNS KSSLGMRTVG HGGSPLSHAV SEPLRYSSNS  360
RLPHARNCFP SGPSGSSLAN ISNGSVLDTN YSSNSYADMF CKKLWETNCG FLAHANQFSV  420
QSNCGFSALA NQCPEQSNGE FLAPASRFPV QLNGGVLVPA NQCPVQSNGG FLAPANQLPV  480
QSNCRFLAPA DQFPVQYPDL NNHPLVQMNP PSTNLLSTVG NTHHFPDLGN CSKSWQTTAP  540
SMFHGLYHKD GTSLGPSQTS IPNINQLSNF ATSSGQVLMF GNELHGPMST IMSDSTSVTD  600
FNEQMGPFNI GNNTSSTEML HRSFTLGSNS SISPTIPSDS SISSTFPGLQ VDSFAMPTQM  660
LNGGDTNGIF PVLSDTIDQQ DIFDQLDDNN GFLTRTNGPE GTGTLDDIVA GLFNHDFAKG  720
DGAVVDEGQE FVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-20195258164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168178RTRRKYSRKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015693656.10.0PREDICTED: two-component response regulator ORR25-like
SwissprotQ67W500.0ORR25_ORYSJ; Two-component response regulator ORR25
TrEMBLJ3MGA00.0J3MGA0_ORYBR; Uncharacterized protein
STRINGOB06G30440.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135042132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.13e-86response regulator 12